SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028035 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028035
Domain Number 1 Region: 330-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 968-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 3 Region: 815-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000248
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 861-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 5 Region: 504-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 453-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 412-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 8 Region: 921-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.059
Further Details:      
 
Domain Number 9 Region: 767-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 10 Region: 1078-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 11 Region: 1032-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 12 Region: 1126-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028035
Domain Number - Region: 1565-1757
Classification Level Classification E-value
Superfamily Tropomyosin 0.0314
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number - Region: 104-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.074
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028035   Gene: ENSMMUG00000021289   Transcript: ENSMMUT00000029956
Sequence length 1760
Comment pep:known_by_projection chromosome:MMUL_1:3:145446561:145549343:-1 gene:ENSMMUG00000021289 transcript:ENSMMUT00000029956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYTQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQNDSLDKYYYALYEMVVRGSCFCNGHASECRPMQKVRGDVFSPPGTVKHGDLVERD
HIGLVQKCFVVLCRAPWRVASGCPDQCGACSCNSHSSRCHFDMTMYLASGGLSGGVCEDC
QHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVAGQ
CLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPLLTCDVDTGQCLCLSYVT
GAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNMCSPKNGQCECRPHVTGRSCSEPAPG
YFFAPLNFYLYEAEEAMPLQGLAPLGSETFGQSPAVHIVLGEPVPGNPVTWTGPGFARVL
PGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTVQIMVNPSRGSEHCVPKTSQSKPQSFA
LPAATRIMLLPTPICLEPDVQYSIDVYFSQPLERESYTHSHILVDSLGLIPQINSLENFC
SKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSSCS
RLGGQCQCKSLVVGRCCDRCSPGSYGLGHHGCHPCHCHPQGSKDTVCDLVTGQCPCHGEV
SGRRCDRCLAGYFGFPSCRSCPCNGFAELCDSETGSCFNCGGFTTGRNCERCIDGYYGNP
SSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNPRI
SGAPCQPCPCNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCRRC
SCHASGVSPVECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSCDC
DPRTSQSSHWDGLTGQCPCKLGYGGKHCSECQENYYGDPPGRCIPCDCNRAGTQKPICDP
DTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMRLAAN
MEDKRETLPVCKADFKGLRENMSEIERILKHPVFPSGKFLKVKDYHDSVRKQIMQLNEQL
KAVYEFQDLKHTIERAKNEADLLLEDLQKEIDLQFSVLNASIVDSSENIKKYYHISSSAE
KKINETSSTINTSANTRNDFLTILNTLTSKGNLSLEKLKQIKIPDIQILNEKVCGDPGNV
PCVVPLPCGGAVCMGQEGHRKCGGAGCHGSLTLSTNALQKAQEAKSVIRNLDKQVRGLKN
QIKNISKLAEVSKNNALQLREKLGNTRNQSDSEEEKLNLFIKKVKNFLLEENVPPEDIEK
VANGVLDIHLPIPSQNLMDEVNKIQKLMQLCEDYRSDENRLSEEEDGAQKLLVKAKAAEK
AANVLLNLDKTLNQLQQAQITHGRANSTITQLTANITKIKKNVLQAENQTREMKNELESA
KQRSGLEDGLALLQTKLQRHEDHAVNVKVQAESAQHQAGSLEKEFVELKKQYAVLQHKTS
TTGLTKETLGKVKQLKDAAEKLAGDTEDKIRRITDLERKIQDLNLSRQAKADQLRILEDQ
VVAIKNEIVEQEKKYATCYS
Download sequence
Identical sequences 9544.ENSMMUP00000028035 ENSMMUP00000028035 ENSMMUP00000028035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]