SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028041 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028041
Domain Number 1 Region: 41-100
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000398
Family VWC domain 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028041
Domain Number - Region: 1291-1332
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0722
Family Fibrinogen C-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028041   Gene: ENSMMUG00000021290   Transcript: ENSMMUT00000029962
Sequence length 1497
Comment pep:known_by_projection chromosome:MMUL_1:12:52670754:52751229:-1 gene:ENSMMUG00000021290 transcript:ENSMMUT00000029962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLLVMYNRTAVSSLLILSFLIHTFKNKILKEALSEGYGEEIACTQNGQMYLNRDIWKPAP
CQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGKMRKGQKGEP
GLVPVVTGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGH
PSHPGPDGMSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGP
PGEPGDPGPMGPIGTRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGL
KGHRGHKGLEGPKGEVGAPGSKGEAGPTGSMGAMGPLGPRGMPGERGRLGPQGAPGQRGA
HGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGL
PGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQLGDPGVPGFKGE
AGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGP
KGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGR
PGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGP
PGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGE
RGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGD
RGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGE
NGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGG
RGTQGPPGATGFPGSAGRVGPPGPAVSQGTFSYLTTLIPVMHTGISAKQIILNNIVFLGG
ANFALCPIDFHLQFSDLGKGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGK
VGPTGATGDKGPPGPALLGGNQCLIGKGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQ
GAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRGQK
GHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPGVR
GSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMSDPLPEFTEDQAAPDDKN
KTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSVED
AIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSPNT
AITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIRFR
YIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGIEIGPVCFV
Download sequence
Identical sequences 9544.ENSMMUP00000028041 ENSMMUP00000028041 ENSMMUP00000028041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]