SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028044 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028044
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000178
Family VWC domain 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028044
Domain Number - Region: 1254-1295
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0701
Family Fibrinogen C-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028044   Gene: ENSMMUG00000021290   Transcript: ENSMMUT00000029965
Sequence length 1460
Comment pep:known_by_projection chromosome:MMUL_1:12:52672308:52750393:-1 gene:ENSMMUG00000021290 transcript:ENSMMUT00000029965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGYGEEIACTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGEC
CPVCSQTPGGGNTNFGKMRKGQKGEPGLVPVVTGIRGRPGPAGPPGSQGPRGERGPKGRP
GPRGPQGIDGEPGVPGQPGAPGPPGHPSHPGPDGMSRPFSAQMAGLDEKSGLGSQVGLMP
GSVGPVGPRGPQGLQGQQGGAGPTGPPGEPGDPGPMGPIGTRGPEGPPGKPGEDGEPGRN
GNPGEVGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGSMGAM
GPLGPRGMPGERGRLGPQGAPGQRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPT
GARGPEGPQGQRGETGPPGPVGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSP
GPQGSTGPQNNKGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPP
GPVGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLT
GNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNA
GVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQ
GVPGDPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDT
GPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEK
GEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSP
GPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAVSQGTFSYLTTL
IPVMHTGISAKQIILNNIVFLGGANFALCPIDFHLQFSDLGKGPDGPPGPAGTTGQRGIV
GMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPALLGGNQCLIGKGPAGNDGTPG
RDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRG
LPGPQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPG
PVGPSGKEGNPGPLGPIGPPGVRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGH
YDESMSDPLPEFTEDQAAPDDKNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDL
KLCHSAKQSGEYWIDPNQGSVEDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKP
VWYGLDMNRGSQFAYGDHQSPNTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNL
KKAVVLKGANDLDIKAEGNIRFRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAP
VDVGGTDQEFGIEIGPVCFV
Download sequence
Identical sequences ENSMMUP00000028044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]