SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028054 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028054
Domain Number 1 Region: 285-415
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-30
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 1174-1291
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-25
Family Cadherin 0.005
Further Details:      
 
Domain Number 3 Region: 533-650
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-24
Family Cadherin 0.00079
Further Details:      
 
Domain Number 4 Region: 646-753
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 759-861
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 962-1073
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 870-974
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0055
Further Details:      
 
Domain Number 8 Region: 1078-1186
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-16
Family Cadherin 0.012
Further Details:      
 
Domain Number 9 Region: 160-288
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000012
Family Cadherin 0.0045
Further Details:      
 
Domain Number 10 Region: 406-531
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.007
Further Details:      
 
Domain Number 11 Region: 1277-1331
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000714
Family Cadherin 0.0062
Further Details:      
 
Domain Number 12 Region: 70-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000012
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028054   Gene: ENSMMUG00000021300   Transcript: ENSMMUT00000029975
Sequence length 1346
Comment pep:known chromosome:MMUL_1:5:146523535:146692834:-1 gene:ENSMMUG00000021300 transcript:ENSMMUT00000029975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPCGRKMGEGRQQRGAPVGKRLQFPGRRDTPRGRSGSSSARTQRSLLWLLVHVWLWAAS
GSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHP
DTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPFDSLQLDVSELS
PPGTAFRLPGAHDPDAGLFSTQGYTLVQPSDPPKDPAGPFFELRYGTPGPLPSPFLPGSS
SPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGRLSVELRVLDENDNPPVFEQDE
YRAAVREDAQLGAEVCRVRATDRDLGPNGFVRYSIRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRLRRPLDREAQAWHQLVVEARDGGVEPEVATVRVSIAVLDVNDNRPAIHVLFLTE
GGLACVSEGARPGDYVARVSVSDADRDWEKEDEATGELSVGLGDPSILLSLEGGEGTFAL
RPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTAVMWVSASDADEAGTEHAWLRYTLVQLSAPCNPEALPAAECGPS
FAIDPESGVISTIRTLDREVQEAVELRVVARDLGEPPLSATCLVSITVDDVNDNEPIFWR
QVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPHDGRIC
VSQDIDRERDPATYDLLVKAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSISGETQ
PGTEIINVLATDRDSGIYGTVAYELIPGDVSSLFTIDSTTGIIYLTSPLSHLESTTLSLM
VSAQDSGGLTAVINAEVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKAREPLN
SSEPIFYRISSGDLGGKFSIHPWLGTIRTRKPLDHETQPVVVLTVQAQLGSAPACSSTEV
NITVLDVNDNHPAFLRTSDEIRISQTTQPGTALYLARAEDRDSGRNGLLRYSIASPQPGV
FAIDRALGVLFLNGSLGAGERRELTLILRAEDQGVPPRAALLVLTVVIEKREHSPSWTFE
HLVYQVEVSESLSPTTQILQTQAHPLGPQRAASPLRYSLEPSVDSAVFGIRPYTGWIYLR
RQLDYESTQTYNFRVFAWIPEDGLLQNVSTTVTVHVRDENDNSPTFLHDVLFLKVEESPV
PQGVIGKITAIDIDYGRNGQLLYFLLSDGRFFKMNPNTGSTSYTIEPNYYHRGHHQMTVL
VTDRGSPPRNATMVVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVKMLVTTVFAKDP
DEGNNAEVIYSVSSARPMPLKGKTLF
Download sequence
Identical sequences ENSMMUP00000028054 ENSMMUP00000028054 9544.ENSMMUP00000028054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]