SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028055 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028055
Domain Number 1 Region: 278-408
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-30
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 521-668
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-29
Family Cadherin 0.00043
Further Details:      
 
Domain Number 3 Region: 153-281
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000457
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 394-527
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000357
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 63-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000005
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028055   Gene: ENSMMUG00000021300   Transcript: ENSMMUT00000029976
Sequence length 697
Comment pep:known chromosome:MMUL_1:5:146687946:146692813:-1 gene:ENSMMUG00000021300 transcript:ENSMMUT00000029976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEGRQQRGAPVGKRLQFPGRRDTPRGRSGSSSARTQRSLLWLLVHVWLWAASGSSAQLF
NLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRT
ARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPFDSLQLDVSELSPPGTAFR
LPGAHDPDAGLFSTQGYTLVQPSDPPKDPAGPFFELRYGTPGPLPSPFLPGSSSPLEPLD
LVLLRRLDREEAAAHRLQIEAWDGGRPRRTGRLSVELRVLDENDNPPVFEQDEYRAAVRE
DAQLGAEVCRVRATDRDLGPNGFVRYSIRARQVPGAGSGGGALGDAAYFAVEELSGVVRL
RRPLDREAQAWHQLVVEARDGGVEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGLACVS
EGARPGDYVARVSVSDADRDWEKEDEATGELSVGLGDPSILLSLEGGEGTFALRPGGPPG
VFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKAS
VSEAAAPGTAVMWVSASDADEAGTEHAWLRYTLVQLSAPCNPEALPAAECGPSFAIDPES
GVISTIRTLDREVQEAVELRVVARDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATI
AEHAPVGHCFLQLISAQVAFVKNKQKQNEIQEKQNLS
Download sequence
Identical sequences ENSMMUP00000028055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]