SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028060 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028060
Domain Number 1 Region: 226-487
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.03e-97
Family Fibrinogen C-terminal domain-like 0.0000000000661
Further Details:      
 
Domain Number 2 Region: 88-224
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 4.28e-65
Family Fibrinogen coiled-coil and central regions 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028060   Gene: ENSMMUG00000021302   Transcript: ENSMMUT00000029981
Sequence length 491
Comment pep:known_by_projection chromosome:MMUL_1:5:146764134:146772213:1 gene:ENSMMUG00000021302 transcript:ENSMMUT00000029981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRMVSWSFHKFKTMKHLLLLLLCVFLVKSQGVNGNEESPFSGRGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAASQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRSSVDELKNSVQIVSQTSSSTFQYTYLLKDMWQKRQKQVKDNENVVNEYSSDLEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWNPYK
QGFGNIATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLTGENRTMTIHNGMFFSTYDRDNDGWLTADP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGKYTWDMAKHGTDDGVVWMNWKGSWYSMKKM
SMKIRPFFPQQ
Download sequence
Identical sequences F6UZ87 G7P6F7
ENSMMUP00000028060 9544.ENSMMUP00000028060 ENSMMUP00000028060 XP_005556177.1.63531 XP_014994859.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]