SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028061 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028061
Domain Number 1 Region: 622-857
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.97e-85
Family Fibrinogen C-terminal domain-like 0.00000000274
Further Details:      
 
Domain Number 2 Region: 46-235
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 4.58e-72
Family Fibrinogen coiled-coil and central regions 0.00000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028061   Gene: ENSMMUG00000021303   Transcript: ENSMMUT00000029982
Sequence length 860
Comment pep:known_by_projection chromosome:MMUL_1:5:146785912:146792665:-1 gene:ENSMMUG00000021303 transcript:ENSMMUT00000029982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSMRIVCLVLSVVGTGWTADTGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
NYKCPSGCRMKGLIDEVNQDFTSRINKLKNSLFDYQKNNKDSNSLTTNIMEILRGDIVSS
NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQQNVRAQLVDMKRLEVDVDIKIRSC
RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMNPVPDLFPPNFKSQ
LQKVPPEWKALTDMQQMRMELERPGGNEVTQVGSTSYRTGSETESPRNPSSAGSWNPGSS
GPGSTGHQSPGSSGPGSTGTWKPGSSGPGSTGTWNPGSSGTTGNQNTGSPRPGSTGTWNP
GSSGHGSAGHWSSESSVSSSTGHWHSGSGSFRPDSSGSGNTRPTNPDWGTFEEVPGNVSP
GTNREHRTEKLVTSKGDKELVVGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEV
VTSEDGSDCPEAIDLGIGTLDEFRHRHPDAAAFFDTASTGKTFPGFFPSTFREFASEAES
MGSESGTFTNTKETSSHHSGVAEFPSSGKTSSHSKQFISSTAYNREGSTFESKSYKMADE
AGSEADHEGTHSTKRGHAKSRSSRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQE
TSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRV
ELEDWAGNEAYAEYYFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGTEYTSHNSMQFS
TFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYLGGSYDPRNNSPYEIENGVVWVSF
RGADYSLRAVRMKIRPLLTQ
Download sequence
Identical sequences ENSMMUP00000028061 9544.ENSMMUP00000028061 ENSMMUP00000028061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]