SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028065 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028065
Domain Number 1 Region: 4-253
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.02e-93
Family Fibrinogen C-terminal domain-like 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028065   Gene: ENSMMUG00000021304   Transcript: ENSMMUT00000029986
Sequence length 265
Comment pep:known chromosome:MMUL_1:5:146806271:146814777:-1 gene:ENSMMUG00000021304 transcript:ENSMMUT00000029986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQVFDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVLQKRLDGSVDFKK
NWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYATFK
VGSEADKYRLTYAYFAGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNC
AEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKSRWYSMKKTTMKI
IPFNRLTIGEGQQHHLGGAKQAGDV
Download sequence
Identical sequences ENSMMUP00000028065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]