SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028067 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028067
Domain Number 1 Region: 172-425
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.2e-94
Family Fibrinogen C-terminal domain-like 0.000000000084
Further Details:      
 
Domain Number 2 Region: 30-167
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 2.52e-61
Family Fibrinogen coiled-coil and central regions 0.00000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028067   Gene: ENSMMUG00000021304   Transcript: ENSMMUT00000029988
Sequence length 453
Comment pep:known chromosome:MMUL_1:5:146806708:146814788:-1 gene:ENSMMUG00000021304 transcript:ENSMMUT00000029988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWSLQPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
EVDKDLQSLEDILHQVENKTSEVKELIKAIQLSYNPDESSKPNTIDTATLKSRKMLEEIM
KYEALILTHDASIRFLQEIYNTNNQKIVNLKQKVAQLEEQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVLQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYATFKVGSEADKY
RLTYAYFAGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKSRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQVRQEHPVETEYDSFYPEDDS
Download sequence
Identical sequences F6UYY8 G7P6F9
ENSMMUP00000028067 9544.ENSMMUP00000028067 XP_001089651.1.72884 ENSMMUP00000028067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]