SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028100 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028100
Domain Number 1 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.01e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 292-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-18
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 654-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 532-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000559
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000737
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000137
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028100   Gene: ENSMMUG00000021333   Transcript: ENSMMUT00000030025
Sequence length 700
Comment pep:novel chromosome:MMUL_1:19:21844100:21854432:1 gene:ENSMMUG00000021333 transcript:ENSMMUT00000030025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVFQGPLTFMDVVIKFSPEEWQFLDTAQQNLYRDVMLENYRNLVFLVTVINSCFGVNIL
EYSITFSLLSTLFEEYEQHSCYPVLNYFLSSLVLPCLKYMWFANSFILKIVVVVLKQNLT
LSLSRLKLHLKKKKCFLKFLIFILFSRILIVCYFLSLFFIFEMDSCSVTPNKSSLATPVP
CLLYCSFSATVTFTFSLSKLKVSLQIILRRYGKYGHDNLQLRKGCESVDECKMHKGGYDE
LKQCLITTRNKIFQCDKYVKVFHKFSSSNSHNIRHTGNNSFKCKECGKSCCMLSHLTQHE
RTHTRVNRYKCKECGKAFSMPTSLNNHKRIHTGEKPYKCEECGKAYNWPSIISKHKRIHT
GKKPYKCEECGKAFSESSSLNNHKRIHTGEKPYTCEECGKSYNWPSIISKHKRIHTGKKP
YKCEECGKAFSESSSLNNHKRIHTGEKPYKCEECGKAYNWPSTISKHKRIHTGKKPYKCE
ECGKAFSESSNLNSHKRIHTGEKPYKCEECGKAFSESSSLNNHKRIHTGEKPYKCEECGK
AFKIRAYLTTHNRIHTGEKPYKCKECGKAFSGSSSLNNHKIIHSGEKPYKCEECGKAFKI
RAYLTTHNRIHTGEKPYKCEECGKAFNRSSSLTIHNRIHTVEKPYKCKQCGKGFSQSSSL
TKHKIIHTTEKPYKCEECGKAFNKSSILNIHKMIHTKEKP
Download sequence
Identical sequences ENSMMUP00000028100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]