SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028145 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028145
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.31e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 242-420
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.44e-30
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 96-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.05e-26
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 4 Region: 470-492,694-858
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-21
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 5 Region: 868-1018
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-19
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 477-534
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000102
Family Fibrinogen C-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028145   Gene: ENSMMUG00000008054   Transcript: ENSMMUT00000030075
Sequence length 1018
Comment pep:known chromosome:MMUL_1:12:106157835:106287652:-1 gene:ENSMMUG00000008054 transcript:ENSMMUT00000030075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMCLSPQTGAGGWTPLVSNKNQWLQIDLGERVEVTAVATQGGYGSSDWVTSYILMFSDSG
RNWKQYRREDSISGFLGNANADSVVQHRLWPPLEARYLRFLPVAWNPDSRIGMRVEAYGC
AHRSEVIDFDGESSLLYRFIQNTRSPGTDIISLKFKTLQSDGILFHRDGRNGNCITLELV
KGKLILFINSGNATQPSPPGQGGLALGSLLDDGHWHTVRLECSGRGLNLTVDRHSRPIWA
PAELCHADLDPEGTVAFACAHPQTVPATFLSAQSHLALPGSPGADAASVSFQFRTWNRAG
LLLSWGTRPGSGGFFLALQDGRLHRFVVYGCVLPGLVSTGVGLNDGQWHSVSVTSTWGHL
SVMVDDDVASTVHTTVPVGVHPGDAYHFGGCPAHGSGSDCSRSLGPLGGFQGCLRLISID
GQEVDLISVQQGAVGNFSDLLIDTCGILDRCLPNYCEHEGTCSQTWTAFHCDCSSTGYTG
ATCHRSLYEPSCEAYKHLGHASGFYNIDPDGSGPLKPFQAFCNMTDVPWTVLQHNGSALT
RVKGASLENPHRAVFQYTASAEQLLASIDRARHCQQELELHCRRSRLQDPRDGTALSWWA
GRANETHTYWGGSFPGAHQCACGLERDCLDPQYGCNCDADRDEWTSDVGVLSHREHLPVT
QIVITDADRPGSEAAYKLGPLQCQGDGSFWNSASFHTEASYLHFPTFHGELSADVSFFFK
TTASSGVFLENLGITDFISLELRSPAEVAFSFDVGNGPCELTVQSEVYTHRHTWKYIHTS
RNMEETCLQLESNSDNFQPYPLLHSPLNKMNQTQLFSSGTAARQRGFLGCIRALQVNGRT
LDLEGRAKVTPGVEPGCPGHCSTYGHLCLHGGQCREGHQGFSCDCELSAYTGPFCSSEIS
AYFGTGSSVTYNFQEYHSPSTNASSHAASFQGETTLTQETIAFSFRTVQAPSLLLYVDSF
YKEYLSVILAKNGSLQIRYKLDTHQDPDVVNLNFRNMADGKLYHVNISREDGVVFVEV
Download sequence
Identical sequences ENSMMUP00000028145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]