SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028160 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028160
Domain Number 1 Region: 207-279
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.22e-26
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.5e-25
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028160   Gene: ENSMMUG00000021376   Transcript: ENSMMUT00000030090
Sequence length 328
Comment pep:known_by_projection chromosome:MMUL_1:10:73134960:73138431:1 gene:ENSMMUG00000021376 transcript:ENSMMUT00000030090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYSLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRTELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETTPAPGTPARAPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTGQPGISCPPIPPAATPGTVTS
APPPRAAPLVPAVMTQALAPGGSDPAGG
Download sequence
Identical sequences ENSMMUP00000028160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]