SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028281 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028281
Domain Number 1 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.39e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-22
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 22-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 542-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000722
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028281   Gene: ENSMMUG00000021468   Transcript: ENSMMUT00000030220
Sequence length 615
Comment pep:known chromosome:MMUL_1:19:50399167:50403781:1 gene:ENSMMUG00000021468 transcript:ENSMMUT00000030220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPSFELLHSGLCKFPEVEGKMTTFKEAVTFKDVAVVFTEDELGLLDPAQRKLYRDVMLE
NFRNLLSVGNQPFHQDTFHFLRKEKLQMMKTTSQRGGNSGGKIQIEMETVPEAGPHEEWS
CQQIWEQIASDLTRSQDSIRNSSELFIEGDVLCQIEAGLSISHVQQKSYQCNECKQSFGD
VSVFDLHQQLHSGEKSHTCDECGKSFCYISALRTHQRVHMGEKHYKCDVCGKEFNQSSHL
QTHQRVHTGEKPFKCEQCGKGFHSRSALNVHCKLHTGEKPYNCEECGKAFIHDSQLQEHQ
RIHTGEKPFKCDICGKSFRVRSRLNRHSMVHTGEKPFRCDICGKNFRQRSALNSHSMVHI
GEKPYKCEQCGKGFICRRDFCKHQMVHTGEKPYNCKECGKTFRWSSCLLNHQRVHSGQKP
FKCEECGKGFYTNSQRSSHQRSHNGEKPYKCEECGKGYKRRLDLEFHQRVHTGERPYNCK
ECGKSFGWASCLLKHRRLHSGEKPFKCEECGKRFTQSSQLHSHQTCHTGEKLYKCEQCEK
GYNSKFNLDMHQRVHRGERPYNCKECGKSFGWASCLLKHQRLHSGEKPLKCGVWEEISEF
TAPFTSESLCGKKAI
Download sequence
Identical sequences ENSMMUP00000028281 ENSMMUP00000028281 9544.ENSMMUP00000028281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]