SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028456 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028456
Domain Number 1 Region: 99-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.72e-33
Family PDI-like 0.0074
Further Details:      
 
Domain Number 2 Region: 232-339
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-32
Family PDI-like 0.0044
Further Details:      
 
Domain Number 3 Region: 2-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.05e-22
Family PDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028456   Gene: ENSMMUG00000021601   Transcript: ENSMMUT00000030406
Sequence length 345
Comment pep:novel chromosome:MMUL_1:4:7806932:7829200:-1 gene:ENSMMUG00000021601 transcript:ENSMMUT00000030406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQE
AVKYQGPRDFQTLENWMLQTLSEEPATPEPEVEPPRAPELKQGLYELSASNFELHVAQGD
HFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLW
FRDGKKVDQYKGKRDLESLREYVELQLQRTETGATETVKPSEAPVLAAGPEADKGTVLAL
TENNFDDTIAEGITFIKFYAPWCGHCKNLAPTWEELSRKEFPGLAGVKIAEVDCTAERSI
CSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLGQAKDEL
Download sequence
Identical sequences 9544.ENSMMUP00000028456 ENSMMUP00000028456 ENSMMUP00000028456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]