SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028476 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028476
Domain Number 1 Region: 108-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 85-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000299
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028476
Domain Number - Region: 177-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00027
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028476   Gene: ENSMMUG00000021621   Transcript: ENSMMUT00000030429
Sequence length 242
Comment pep:known chromosome:MMUL_1:10:51344832:51377588:-1 gene:ENSMMUG00000021621 transcript:ENSMMUT00000030429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPERETPEPGDAEGPDGH
LAAKQRPVARSKIKFTTGTCSDSVVHSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCG
KGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKL
YVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSTHQENTSLSEEEE
RK
Download sequence
Identical sequences ENSMMUP00000028476 9544.ENSMMUP00000028476 ENSMMUP00000028476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]