SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028514 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028514
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000488
Further Details:      
 
Domain Number 2 Region: 259-456
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 7.19e-42
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000797
Further Details:      
 
Domain Number 3 Region: 595-758
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.85e-40
Family AlaX-like 0.034
Further Details:      
 
Domain Number 4 Region: 519-591
Classification Level Classification E-value
Superfamily Translation proteins 9.79e-16
Family AlaX-M N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028514   Gene: ENSMMUG00000021653   Transcript: ENSMMUT00000030472
Sequence length 967
Comment pep:known_by_projection chromosome:MMUL_1:20:72385473:72414702:1 gene:ENSMMUG00000021653 transcript:ENSMMUT00000030472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYIHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIGRLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGHPPPRPANFCIFSRDGVSPFFGFIQPLILLPLCQGDAFP
ELKRDPDMVKDIVNEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGFPV
DLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEVTD
DSPKYNYHLDFSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGGQI
YDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVRLFIDEPRRRPIM
SNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEA
AKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSVEF
CGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKSLSVMEAKVK
AQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVL
EKTKQLIDSNPNQPLVILEMESARSSPQALNEALKLFKTHSPQTSAMLFTVDNEAGKITC
LCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNIGCLQEALQLATSFAQL
RLGDVKN
Download sequence
Identical sequences 9544.ENSMMUP00000028514 ENSMMUP00000028514 ENSMMUP00000028514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]