SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028521 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028521
Domain Number 1 Region: 27-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.98e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 86-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000428
Family LIM domain 0.0021
Further Details:      
 
Domain Number 3 Region: 346-385
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 0.0000000371
Family VHP, Villin headpiece domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1-26
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000803
Family LIM domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028521   Gene: ENSMMUG00000021657   Transcript: ENSMMUT00000030479
Sequence length 394
Comment pep:known chromosome:MMUL_1:6:145681570:145733642:1 gene:ENSMMUG00000021657 transcript:ENSMMUT00000030479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKC
ETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKK
LKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFS
RSPHHYYRSGDLSTATKSKTSEDISQTSKYSPAYSPDPYYASESEYWTYHGSPKVPRARR
FSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYE
MSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIY
PYELLLVTTRGRNRLPKDVDRTRLEGNFWKSGCL
Download sequence
Identical sequences ENSMMUP00000028521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]