SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028529 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028529
Domain Number 1 Region: 27-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-21
Family FAD-linked reductases, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028529   Gene: ENSMMUG00000021663   Transcript: ENSMMUT00000030487
Sequence length 494
Comment pep:known chromosome:MMUL_1:6:145830427:145842104:1 gene:ENSMMUG00000021663 transcript:ENSMMUT00000030487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAAPLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEK
GTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAIFGGEHFVL
EETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGE
STFVNMTQHSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLW
SVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALYQVAYENEVGNSSDFYDIVVI
ATPLHLDNSSSNLTFAGFHPPIDDLQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANIL
TTDFPSFFCTLDNMCPVNISASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTA
EWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDK
IDQKDLMHKVKTEL
Download sequence
Identical sequences A0A2K5WXH5 I2CXM5
NP_001253088.1.72884 XP_005558275.1.63531 ENSMMUP00000028529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]