SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028533 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028533
Domain Number 1 Region: 168-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.11e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000457
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000331
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028533
Domain Number - Region: 91-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0263
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028533   Gene: ENSMMUG00000021668   Transcript: ENSMMUT00000030491
Sequence length 335
Comment pep:known_by_projection chromosome:MMUL_1:16:46926234:46931830:1 gene:ENSMMUG00000021668 transcript:ENSMMUT00000030491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHH
Download sequence
Identical sequences ENSMMUP00000028533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]