SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028543 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000028543
Domain Number - Region: 13-61
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0244
Family Glutathione peroxidase-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028543   Gene: ENSMMUG00000021677   Transcript: ENSMMUT00000030501
Sequence length 110
Comment pep:novel chromosome:MMUL_1:X:2397952:2398410:1 gene:ENSMMUG00000021677 transcript:ENSMMUT00000030501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVEDLAKIPESFLQEANVTLIVIGQSSYHHIEPFCKPTGYSHEIYVDPEREMYKRLGMKR
GEEIAASCPVDIHFIHCDRNRLDHKPINSVLQLVGVQHVNFTNRTSVIHV
Download sequence
Identical sequences 9544.ENSMMUP00000028543 ENSMMUP00000028543 ENSMMUP00000028543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]