SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028685 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028685
Domain Number 1 Region: 200-350
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-17
Family YWTD domain 0.001
Further Details:      
 
Domain Number 2 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000127
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 3 Region: 150-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000958
Family EGF-type module 0.004
Further Details:      
 
Domain Number 4 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 118-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000576
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028685   Gene: ENSMMUG00000021782   Transcript: ENSMMUT00000030650
Sequence length 351
Comment pep:known_by_projection chromosome:MMUL_1:11:54195505:54222676:1 gene:ENSMMUG00000021782 transcript:ENSMMUT00000030650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADSKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDNAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERC
Download sequence
Identical sequences ENSMMUP00000028685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]