SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028697 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028697
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily WWE domain 1.18e-29
Family WWE domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028697
Domain Number - Region: 370-401
Classification Level Classification E-value
Superfamily RING/U-box 0.0134
Family RING finger domain, C3HC4 0.0025
Further Details:      
 
Domain Number - Region: 143-342
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0225
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028697   Gene: ENSMMUG00000021791   Transcript: ENSMMUT00000030662
Sequence length 526
Comment pep:known_by_projection chromosome:MMUL_1:11:114001330:114021438:1 gene:ENSMMUG00000021791 transcript:ENSMMUT00000030662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSL
GFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQC
LLVNSTRAASNAILASQRRKAPPAPPLPLPPPPPPGGPPGALAVRPSATFAGAALWAAPV
TGPAEPAPPPGAPPRSPSAPGGAPTPGQNNLNRPGPQRTTSVSARASIPPGVPALPVKNL
NGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKK
KHLKKSKNPEDVVRRYMQKVKNPPDEVRRGALAWRGQEPSPLLLGSGGQGTEWGWGATGN
SLPASPAQDGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHSLPGFPDTQTIRIVYDIPTG
IQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDT
VVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAAAKA
Download sequence
Identical sequences ENSMMUP00000028697 9544.ENSMMUP00000028697 ENSMMUP00000028697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]