SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028726 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000028726
Domain Number - Region: 108-154
Classification Level Classification E-value
Superfamily ISP domain 0.0929
Family Ring hydroxylating alpha subunit ISP domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028726   Gene: ENSMMUG00000021811   Transcript: ENSMMUT00000030693
Sequence length 222
Comment pep:novel chromosome:MMUL_1:19:40569211:40569923:-1 gene:ENSMMUG00000021811 transcript:ENSMMUT00000030693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGLRKHLKQVAASQHWMLDKLTSVFAPCPSTGSHKLRECLPYALIGDEVKICMQWFIK
MDGKVRTDIIYSAGFIDITSIDKMGENFCLICGINGRFAVHRVILEEAKYKLCKVRKIFV
GTKGIPHLFHDAHTIHCPDSLVKIDLETGKITDFIKFDTGNLFMVIGDANLGRIGVITNG
KKHCGSFDVVHVKDANGNSFATWLSNIFVTGKSNKPRISFPK
Download sequence
Identical sequences 9544.ENSMMUP00000028726 ENSMMUP00000028726 ENSMMUP00000028726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]