SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028794 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028794
Domain Number 1 Region: 18-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.39e-44
Family Type II thymidine kinase 0.000000503
Further Details:      
 
Domain Number 2 Region: 150-195
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000618
Family Type II thymidine kinase zinc finger 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028794   Gene: ENSMMUG00000021867   Transcript: ENSMMUT00000030766
Sequence length 234
Comment pep:known chromosome:MMUL_1:16:73467240:73481907:-1 gene:ENSMMUG00000021867 transcript:ENSMMUT00000030766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDAAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Download sequence
Identical sequences A0A2K5MDC3 H9ZCY8
ENSMMUP00000028794 XP_001107944.3.72884 XP_008011273.1.81039 XP_011844054.1.47321 XP_011897660.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]