SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028862 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028862
Domain Number 1 Region: 25-351
Classification Level Classification E-value
Superfamily L domain-like 3.91e-61
Family Leucine rich effector protein YopM 0.082
Further Details:      
 
Domain Number 2 Region: 395-578
Classification Level Classification E-value
Superfamily L domain-like 2.72e-30
Family Ngr ectodomain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028862   Gene: ENSMMUG00000021921   Transcript: ENSMMUT00000030839
Sequence length 602
Comment pep:known chromosome:MMUL_1:1:72899257:72963052:-1 gene:ENSMMUG00000021921 transcript:ENSMMUT00000030839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLKRIAGQDPRAGFKAAGRDCGTSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINV
DIPEEANQNLSFGATERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSL
PSAMRELENLQKLNVSHNKLKIFPEEITNLRNLKCLYLQHNELTCISEGFEQLSNLEDLD
LSNNRLTTVPASFSSLSSLVRLNLSSNQLKSLPAEINRMKRLKHLDCNSNLLETIPPELA
GMESLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEMLEAEHLKHLNSILVLDLRDNK
LKSVPDEITLLQSLERLDLSNNDISSLPYSLGNLHLKFLALEGNPLRTIRREIINKGTQE
VLKYLRSKIKDDGPSQSESAAETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFN
AVKSNIITSINFSKNQLCEIPKRMVELKEMVSDVNLSFNKLSFISLELCMLQKLTFLDLR
NNFLNSLPEEMESLVRLQTINLSFNRFKMLPEVLYRIFTLETILISNNQVGSVDPQKMKM
MENLTTLDLQNNDLLQIPPELGNCVNLRTLLLDGNPFRVPRAAILIKGTAAILEYLRDRI
PT
Download sequence
Identical sequences F6T4T3 G7NWZ2
9544.ENSMMUP00000028862 ENSMMUP00000028862 NP_001247952.1.72884 ENSMMUP00000028862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]