SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028899 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028899
Domain Number 1 Region: 441-565
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 230-352
Classification Level Classification E-value
Superfamily Cadherin-like 4e-30
Family Cadherin 0.00056
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-22
Family Cadherin 0.0031
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.005
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-18
Family Cadherin 0.00078
Further Details:      
 
Domain Number 6 Region: 30-113
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000357
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028899   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030878
Sequence length 932
Comment pep:known chromosome:MMUL_1:6:137734567:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKCLSFRNGRGLALLCALLGTLCETGSGQIRYSVSEEQDKGSFVGSIAKDLGLKPRELA
ERGVRIVSRGRTQFFSLNPRSGSLVTAERIDREELCAQIPLCLVKFNILVEDKLKIFEVE
IEIKDINDNAPNFPTEELEIKIGELTVPGTRFPLKTAFDPDVGMNSLQNYKLSPNDYFSL
AVNSVSEGAKYPELVLEQALDREKKEIHQLVLVASDGGDPVHSGNLHIQVIVLDANDNPP
MFTQSEYRVSVWENVPVGTRLLTVNATDPDEGFNAQVSYILDKMPGKIAEIFHLNSVSGE
LSILKNLDYEDAMFYEIKIEAQDGPGLLSRAKILLTVLDVNDNAPEITITSLTGSVPEEG
TVGREIALIDVHDRDSGQNGQVAVFVLGNLPFKLEKSIDQYYRLVTATSLDREQMSEYNI
SLRASDGGSPPLSTETHIILNVIDINDNPPTFPHLSYSAYIPENNPRGASIFSVTAQDPD
SNDNAHITYALTEDTLQGAPLSSYVSINSNTGVLYALRSFDYEQFRDLKLLVTASDSGNP
PLSSNVSLNLFVLDQNDNAPEILYPAIPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYHLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADRIPDILADLGSLEPSAKPNDSDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWH
KSRLLQASGGGLASVPGSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIFPQPNYADTLI
SQESCEKSEHLLVTQDLLETKGDSNLLQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences ENSMMUP00000028899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]