SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028910 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028910
Domain Number 1 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-30
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 441-563
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-24
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-22
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 556-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 32-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000257
Family Cadherin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028910   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030891
Sequence length 930
Comment pep:known chromosome:MMUL_1:6:137807587:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSCAQRRRAGPRQVLFPLLLPLFYPALCEPIRYSIPEELAKGSVVGNLAKDLGLSVLD
VSARKLRVSAEKLHFSVDAESGDLLVKDRIDREQICKERRRCELQLEAVVENPLNIFHII
VVIEDINDHAPQFQKDEINLEISESVSPGMGTILESAEDPDISMNSLSKYQLSPNEHFSL
VEKDNPDGGKYPELVLQKTLDRETQSAHHLVLTALDGGDPPRSGTAQIRILVIDANDNPP
VFSQDVYRVSLREDVPPGTSILRVKATDQDEGINSEITYSFLGVADKAQHVFSLDYATGN
ILTQQPLDFEEVERYTMNIEAKDRGSLSTRCKVIIEVLDENDNSPEIIITSLPDQIMEDS
PPGVVVALFKTRDRDSGENGEVRCSLSRGVPFKIHSSSNNYYKLVTDGALDREQTPEYNV
TIAATDRGKPPLSSSKTITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPD
FGPNGRVSYSLVASDLESRTLSSYVSVSAQNGVVFAQRAFDHEQLRAFELTLQACDQGSP
ALSANVSLRVLVGDRNDNAPRVLYPALGPDGSAVFDTVPRAAQPGYLVTKVVAVDADSGH
NAWLSYHVVHASEPGLFSLGLRTGEVRMARALGDKDSVRQRLLVAVRDGGQPPLSATAML
HLVFADSLQEVLPDFSDRPTPSDSQAEMQFYLVVALALISVLFLLAVILAIALRLRQSFS
PTAGGCFESVLCSKSGPVGPPSYNEGTLPYAYNFCVPGDQMNPEFNFVTSVDHCPATQDN
FNKDSSSMLLASILTPSLEANKILKQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQ
FDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNA
TLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences F6S226
ENSMMUP00000028910 XP_014996550.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]