SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028912 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028912
Domain Number 1 Region: 230-351
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-31
Family Cadherin 0.00061
Further Details:      
 
Domain Number 2 Region: 441-565
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-28
Family Cadherin 0.0022
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-24
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 6.81e-19
Family Cadherin 0.0071
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 2.66e-18
Family Cadherin 0.00085
Further Details:      
 
Domain Number 6 Region: 26-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000328
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028912   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030893
Sequence length 934
Comment pep:known chromosome:MMUL_1:6:137811110:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRLQRLDRSGLVLLCIFLGTLRGFRAGQIRYSVPEETEKGYFVGNISKDLGLEPRELA
KRGVRIVSRGKTQLFAVNLRSGSLITAGRIDREELCETVSSCFLNMELLVEDTLKIYGVE
VEIIDINDNAPSFQEDEVEIKVSEHAIPGARFALPNARDPDVGVNSLQNYQLSPNSYFSL
QLRGRMDGAKNPELLLEGSLDREKEVAHLLLLTALDGGDPIRKGSVPIRVVVLDVNDHIP
VFTQSVYRVSVPENISSGTRVLVVNATDPDEGINGEVMYSFRNMESKASEIFQLDSQTGE
VLVRGSLDFEKYGFYEMEIQGQDGGGLFTTAMMLITVVDVNDNTPEITITSSINSILENS
PPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGNYYKLITSRVLDRELVQSYNI
TLTATDQGSPPLSSETHIWLNVVDDNDNPPVFPHSSYFAYIPENNPRGASIFSVTALDPD
SKQNALVTYSLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQFRDLQLRVIARDSGDP
PLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQ
NAWLSYRLLKASEPGLFAVGEHTGEVRTVRALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPEVLADLVSLESLANSETSDLTLYLVVAVAAVSCIFLVFVIVLLALRLWRWH
KSRLLQASEGGLAGMPTSHFVGMDGVQAFLQTYSHEVSLIADSQKSHLIFPQPNYGDTLI
SQESCEKSEPLLIAEDSAIILGKCDPTSNQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTW
PNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIP
GSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences ENSMMUP00000028912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]