SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028913 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028913
Domain Number 1 Region: 441-565
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-30
Family Cadherin 0.0024
Further Details:      
 
Domain Number 2 Region: 230-349
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-28
Family Cadherin 0.00065
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-23
Family Cadherin 0.0038
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-21
Family Cadherin 0.017
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 6e-18
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 29-113
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000314
Family Cadherin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028913   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030894
Sequence length 932
Comment pep:known chromosome:MMUL_1:6:137821165:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPERPHRDCKDLVLLGILLGILWETRCTQIRYSVPEELEKGSRVGDISKHLGLEPRELA
ERGVRIVPRGRTQLFALNPRSGSLVTAGRIDREELCMGAIKCQLNLDILIEDKVKIYGVE
VEVRDINDNAPYFRESELEIKISENAGTDMRFPLPHAWDPDIGKNSLQSYELSPNTHFSL
IVQNGAEGSKYPELVLERALDREEKAAHHLVLTASDGGDPVRTGTARSRVMVLDANDNAP
AFAQPEYRASVPENLAVGTQLLVVNATAPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGT
ISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVLNVNDNAPEVVLTSLASSVPENS
PRGTLIALLNVNDQDSEVNGQVICFIQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNI
TVTATDRGTPPLPTEIHILLNVADTNDNPPVFLQASYSAYIPENNPRGASLVSVTAHDPD
CEENAQITYSLAEDTVQGAPLSSYVSINSDSGVLYALSSFDYEQLRDLQVKVMARDNGHP
PLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPKVLVDLGSLESPVNSETSDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWH
KSRLLQASEGGLTGAPASHFVGVDGVQAFLQTYSHEVSLTSDSRKSHPILPQPNYADTLV
SQESGGKSESLLLSGDSVFSKDSLALIQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences ENSMMUP00000028913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]