SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028916 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028916
Domain Number 1 Region: 232-358
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-29
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 340-464
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 445-571
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 561-667
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-17
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 31-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000485
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028916   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030897
Sequence length 934
Comment pep:known chromosome:MMUL_1:6:137870585:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEILEEREKGFAVGNVVANLGLDLGS
LSARRLRVVSGASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFS
VEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHITVLDANDN
APVFNQSLYRARVLEDAPSGTRVVQVLATDLDEGPNGEIIYSFGSHNRAGVRELFALDLV
TGMLTIKGRLDFEDTKLHEIYIQAKDKGASPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPAGLPFSLTSSLKNYFTLKTSADLDRETV
PEYNLSITARDAGTPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAPILNLS
VWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADA
GHNAWLSYSLLGAPNQSLFAIGLHTGQISTARPVQDTDSPRQTLTVLIKDNGEPSLSTTA
TLTVSVTEDSPEARAEFPSGSAPREQNKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAAS
PLASRQNTLRSCDPVFYRQVLGAESAPPGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTW
PNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIP
GSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences A0A2K5X214 F6S1Y6
ENSMMUP00000028916 XP_014996541.1.72884 XP_015307516.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]