SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028918 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028918
Domain Number 1 Region: 230-354
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 444-569
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-23
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 580-667
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000193
Family Cadherin 0.005
Further Details:      
 
Domain Number 6 Region: 30-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000385
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028918   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030899
Sequence length 938
Comment pep:known chromosome:MMUL_1:6:137880355:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRKVRSWTEIWRWATLLFLFYHLGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLS
ARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAE
VEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFAL
DVKKRSDGSLVPELLLEKPLDREKQSDYRLVLIAVDGGNPPRSGTAELRVSVLDVNDNAP
AFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTG
KLTLLGPLDFESENYYEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELGTLP
ESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFALKSAFRNQFSLVTAGPLDREAKSS
YDIMVTASDAGNPPLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAAS
DPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDR
GNPPLSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDS
GYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAVPIPADLPPQKLVIVVKDSGSPPLSTSVT
LLVSLEEDTHPVVPDLRESSAPREGESRLTLYLAVSLVAICFVSFGSFVALLSKCLRGAA
CGVTCFPAGTCACLTRSRRREGLPPSNGILRIQLGSDDPIKFVDVGGHSHGCTPLASAPT
RSDSFMMVKSPSAPMAGEPVRPSCPPSDLLYGLEQAPPNTDWRFSQAQRPGTSGSQNGDD
TGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQN
VYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences ENSMMUP00000028918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]