SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028919 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028919
Domain Number 1 Region: 230-351
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-30
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 443-568
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 7e-22
Family Cadherin 0.0057
Further Details:      
 
Domain Number 4 Region: 345-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-20
Family Cadherin 0.01
Further Details:      
 
Domain Number 5 Region: 558-668
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-18
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 29-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000428
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028919   Gene: ENSMMUG00000021963   Transcript: ENSMMUT00000030900
Sequence length 944
Comment pep:known chromosome:MMUL_1:6:137884426:137908118:1 gene:ENSMMUG00000021963 transcript:ENSMMUT00000030900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHKTPPQLAGKWQVLCMLSLCCWGWVSGQLRYSVVEESEPGTLVGNVAQDLGLKMTDLL
SRRLQLGSEENGRYFSLSLMSGALAVNQKIDRESLCGASTSCLLPVQVVTEHPLELIRVE
VEILDLNDNSPSFATHEREMRISESAAPGARFPLDSAQDPDVGTNTVSFYTLSPNSHFSL
NVKTLKDGKPFPELVLEQQLDREAQTRHQLVLTAVDGGTPARSGTTLISVIVLDINDNAP
TFQSSVLRVGIPENAPIGTLLLRLNATDPDEGTNGQLDYSFGDHTSEAVRNLFGLDPSSG
AIHVLGPIDFEESSFYEIHARARDQGQPAMEGHCVIQVDVGDVNDNAPEVLLASLANPVL
ESTPVGTVVGLFNVRDRDSGRNGEVSLDISPDLPFQIKPSENHYSLLTSQPLDREATSHY
TIELLASDAGSPPLHKHLTIRLNISDVNDNAPHFNQQLYTAYILENRPPGSLLCTVAASD
PDTGDNARLTYSIVGNQIQGAPASSFVYVNPEDGRVFAQRTFDYELLQMLQIVVGVRDSG
SPPLHANTSLHVFVLDENDNAPAVLHPRPGWEHSAPQRLPRSAPPGSLVTKVTAVDADAG
HNAWLSYSLLPQSTAPGLFLVSTHTGEVRTARALLEDDSDTQQVVVLVRDNGDPSLSSTA
TVLLVLEDEDPEEMPKSSDFLKHPPERSDLTLYLIVALATVSLLSLVTFTFLSAKCLQGN
ADRDGGGGQCCRRQDLPSRDFYKQSSPNLQVSSDGTLKYMEVTLRPTDSQSHCYRTCFSP
ASDGSDFTFLRPLSVQQPTALALEPDAIRSRSNTLRERSQQAPPNTDWRFSQAQRPGTSG
SQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHV
PDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences F6S1W0
ENSMMUP00000028919 XP_014996537.1.72884 9544.ENSMMUP00000028919 ENSMMUP00000033991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]