SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028978 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028978
Domain Number 1 Region: 1092-1220
Classification Level Classification E-value
Superfamily TNF-like 1.2e-25
Family TNF-like 0.0016
Further Details:      
 
Domain Number 2 Region: 1034-1073
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028978   Gene: ENSMMUG00000022003   Transcript: ENSMMUT00000030961
Sequence length 1221
Comment pep:known_by_projection chromosome:MMUL_1:5:82850689:82910140:1 gene:ENSMMUG00000022003 transcript:ENSMMUT00000030961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMTSASVPPNKIQSLQILPTTWV
MSAEIATAPEARTSEESLLQSTLPPSETSAPAEGVRNQTPTSTERAEGVVKLQNLTLPTK
ANIEFNPGAKPVVLSNSTLKFLQSFARKSNEQATSLNAVGGVGGTGGVGNRAPRETYLSR
GDSSPSQRTDYQKSSFETTRGKNWCAYVHTRLSPTVILDNQVTYVPGGRGPCGWTGGSCP
QRSQKISNPIYRMQHKIVTSLDWRCCPGYSGPKCQLRAQEQQHLIHTNQAESHTAVGRGV
AEQQQQDCGDPEVMRKMTDQVNYQAKKLTLLQNKIDNISLTVNDIRNTYSSLEGKVNEDK
GREFQSLLKDLKSKSINVLVRDIVREQFKMFQNDMQDTVAQLFKTVSSLSEDLESTRQII
KKVNESVVSIAAQQKSVLMQDDRPTLTDIVDLRNHIVNVRQEMTVTCEKPIKELEVKQTH
LEGALEQEHSRSILYYESLNKTLSQLKEVHEQLLSTEQVSDQKNVPAIESLSNNVTEYMS
TLHENIKKQSLMMMQLFEDLHIQESKINNLTISLEMEKESLRGECEDMLSKCRNDFKFQL
KDTEENLHVLNQTLAEVLFPMDNKMDQMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQ
PKEAIVTRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQSRDDTLERRINEYALEMEDG
LNKTMTIVNNAIDFIQDNYALKETLSTIKDNHEVHHKCTSDMETILTFIPQFQRLNDSIQ
ILINDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMFQMFNETTSQVRNYQQNMSHLEEK
MLLATKISKNLETRLQDIESKVTQTLIPYYISLKKGNVVTNERDQALQLQVLNSRFKALE
AKSIHLSSNFFLLNKTLHEVLTMCHNASTSVSELNATIPKWIKRSLPDIQLLQKGLTEFV
EPIIQIKTQAVLSNLTCCIDQSLPGSLANVVKSKKQVKSLPKKINMLKKPTVNLTTVLIG
RTQRNTDNVIYPEEYSSCSRHPCQNGGTCINGRTSFTCACRHPFTGDNCTIKLVEENALA
PDFSKGSYRYAPMVAFFASHTYGMTTPGPILFNNLDVNYGASYTPRTGKFRIPYLGVYVF
KYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGDALLELNYGQEVWLRLAK
GTIPAKFPPVTTFSGYLLYRT
Download sequence
Identical sequences ENSMMUP00000035005 9544.ENSMMUP00000028978 ENSMMUP00000028978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]