SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028989 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028989
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.19e-61
Family Phosphofructokinase 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028989   Gene: ENSMMUG00000004935   Transcript: ENSMMUT00000030973
Sequence length 178
Comment pep:known_by_projection chromosome:MMUL_1:9:3381110:3406072:1 gene:ENSMMUG00000004935 transcript:ENSMMUT00000030973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRILP
GKYLEEIATQMRTHSINALLIIGGFEAYKSACDMAEARGRHQELCIPLCVVPATISNNVP
GTEISLGADTSLNVIVQTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADA
Download sequence
Identical sequences ENSMMUP00000028989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]