SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029152 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029152
Domain Number 1 Region: 1669-1850
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-34
Family Laminin G-like module 0.000000034
Further Details:      
 
Domain Number 2 Region: 1072-1255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.49e-32
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1255-1443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.16e-27
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 4 Region: 887-1063
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-24
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 1522-1663
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-20
Family Laminin G-like module 0.00000518
Further Details:      
 
Domain Number 6 Region: 155-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 7 Region: 212-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 575-805
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000262
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0092
Further Details:      
 
Domain Number 9 Region: 262-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family Laminin-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029152
Domain Number - Region: 373-617
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0032
Further Details:      
 
Domain Number - Region: 112-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family Laminin-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029152   Gene: ENSMMUG00000022136   Transcript: ENSMMUT00000031148
Sequence length 1853
Comment pep:known chromosome:MMUL_1:4:134384800:134586518:-1 gene:ENSMMUG00000022136 transcript:ENSMMUT00000031148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVHRTVT
REDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRRTAVTPPAHLIEKCDCPLG
YSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAG
DFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVTEGLDDYRCTACPRGYEGQY
CERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGICTCRPGATGRKCDGCKHWHA
REGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQELKHLLSP
QRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKEL
ARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELV
AAEGLLKKVKKLFGESRGKNEEMEKDLREKLADYKNKVDDAWDLLREATNKIREANRLFA
VNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPP
MSEELNNKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAF
KAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGSLQKSFRILNEAKKLA
NDVKENEDHLNGLKTRIENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDKARQAN
DTAKDVLAQIKELHQNLDGLKKNYDKLADSVAKTNAVVKDPSKNRVFADADATVKNLEQE
ADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKG
SYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTID
DSYWYRIMASRTGRNGTISVRALDGPKASIVPSTYHSTSPPGYTILDVDANAMLFVGGLT
GKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDG
EGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKVSYDLG
SGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKAD
DKIYFGGLPTLRNLRPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTV
SFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQAYYAIL
LNRGRLEVHLSTGARTMRKIVVRPEPNLFHDGREHSVHVERTRGIFTVQVDENRRYMQNL
TVEQPLEVKKLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSVPMDFARPVSFKNADIGR
CVHQKLHEDEDGAAPAETVIQPEPVPTPAFPTPTAVLTHGPCAAESEPALLMGSKQFGLS
RNSHIAIAFDDTKVKNRTEYSCLIKFNLLHLLINEASFSFNLLSTVENRMLFEPEEPNVG
NHGDTNTLIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPRKADILDVVGMLYVGG
LPINYTTRRIGPVTYSIDGCIRNLHMAEAPADLEEPTSSFHIGTCFANAQRGTYFDGTGF
AKAVGGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFT
AVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSLNPASTSADTNDPVFVGGF
PDDLKQFGLTTSIPFRGCVRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Download sequence
Identical sequences ENSMMUP00000029152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]