SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029154 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029154
Domain Number 1 Region: 2902-3083
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-34
Family Laminin G-like module 0.000000034
Further Details:      
 
Domain Number 2 Region: 2301-2488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.2e-31
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 2484-2676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-26
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 4 Region: 2116-2292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-24
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 2744-2896
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-20
Family Laminin G-like module 0.00000449
Further Details:      
 
Domain Number 6 Region: 779-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 829-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000963
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 8 Region: 1384-1435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 721-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 1441-1493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 11 Region: 882-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 12 Region: 250-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 13 Region: 1024-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 931-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 377-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.081
Further Details:      
 
Domain Number 16 Region: 978-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1851-2034
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000144
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0098
Further Details:      
 
Domain Number 18 Region: 307-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 19 Region: 1491-1531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 20 Region: 52-131
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000964
Family APC10-like 0.038
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029154
Domain Number - Region: 1083-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000187
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1797-1902
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000288
Family ADP-ribosylating toxins 0.028
Further Details:      
 
Domain Number - Region: 1341-1370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family Laminin-type module 0.076
Further Details:      
 
Domain Number - Region: 447-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 1649-1748,1779-1847
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0641
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029154   Gene: ENSMMUG00000022136   Transcript: ENSMMUT00000031150
Sequence length 3086
Comment pep:known chromosome:MMUL_1:4:134384800:134840906:-1 gene:ENSMMUG00000022136 transcript:ENSMMUT00000031150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRH
PITNAIDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERS
LDDVEYKPWQYHAVTDTECLTLYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHIS
LINGRPSADDPSPELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYS
VKDISVGGMCICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLT
KTECEACNCHGKAEECYYDENVARRSLSLNIHGKYIGGGVCINCTQNTAGINCETCIDGF
FRPKGVSPNYPRPCQPCHCNPIGSLNEVCVKDEKHAQRGLAPGSCHCKTGFGGVSCDRCA
RGYTGYPDCKACNCSGLGSKNEDPCFGPCNCKENVEGGDCSRCKSGFFNLQEDNWKGCDE
CFCSGVSDRCQSSYWTYGKIQDMSGWYLTDLSGHIRVAPQQDDSDSPQQISISNAEARQA
LPHSYYWSAPASYLGNKLPAVGGQLTFTISYDLEEEEEDTEHVLQFMIILEGNDLRISTA
QDEVYLHPSEEHVNVLLLKEESFTIHGTHFPVSRKEFMTVLANLKRVLLQITYSFGMDAI
FRLSSVNLESAVSYPTDGSVAAAVEVCQCPPGYTGSSCQSSCWPRHRRVNGTIFGGICEP
CQCFGHAESCDDVTGECLNCKDHTDGPYCDKCLPGFYGDPTKGTSEDCQPCACPLNIPSN
NFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIP
GSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDARNCQPCRCNANGSFSEICHSQTGQ
CECRANVQGQRCDKCKPGTFGLQSARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKC
DRCAHGYFSFQEGGCTACECSHLGNNCDPKTGQCICPPNTIGEKCSKCAPNTWGHSITTG
CKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDAT
TCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCQPGKFGLDAKNPLGCSSCYCFGTTTQCS
EAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHWEPFYWK
LPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLI
GQLTRHEIEMTEKEWKYYGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISE
ISMEVAEQGRRTAVTPPAHLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGT
CVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISS
SNNFSPSCVTEGLDDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLP
VPCDPVTGICTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSI
NLTGPLPAPYKMLYGLENMTQELKHLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATK
VTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEG
LQKEIDQMIKELRRKNLETQKEIAEDELVAAEGLLKKVKKLFGESRGKNEEMEKDLREKL
ADYKNKVDDAWDLLREATNKIREANRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGN
DILDEANRLADEINSIIDYVEDIQTKLPPMSEELNNKIDDLSQEIKDRKLAEKVSQAESH
AAQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLA
TGPRGLLKEDAKGSLQKSFRILNEAKKLANDVKENEDHLNGLKTRIENADARNGDLLRAL
NDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQIKELHQNLDGLKKNYDKLADSV
AKTNAVVKDPSKNRVFADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQ
ARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLA
IEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIMASRTGRNGTISVRALDGPKASIV
PSTYHSTSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLW
NFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSAL
LMYLATRDLRDFMSVELTDGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANI
SIVDIDTNQEENIATSSSGNNFGLDLKADDKIYFGGLPTLRNLSINKKPEVNLKKYSGCL
KDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFST
KNESGIILLGSGGTPAPPRRKRRQTGQAYYAILLNRGRLEVHLSTGARTMRKIVVRPEPN
LFHDGREHSVHVERTRGIFTVQVDENRRYMQNLTVEQPLEVKKLFVGGAPPEFQPSPLRN
IPPFEGCVWNLVINSVPMDFARPVSFKNADIGRCVHQKLHEDEDGAAPAETVIQPEPVPT
PAFPTPTAVLTHGPCAAESEPALLMGSKQFGLSRNSHIAIAFDDTKVKNRTEYSCLIKFN
LLHLLINEASFSFNLLSTVENRMLFEPEEPNVGNHGDTNTLIPTKINDGQWHKIKIMRSK
QEGILYVDGASNRTISPRKADILDVVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNLHMA
EAPADLEEPTSSFHIGTCFANAQRGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRTTGV
LLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHR
IELTVDGNQVEAQSLNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCVRSLKLTKG
TGKPLEVNFAKALELRGVQPVSCPAN
Download sequence
Identical sequences ENSMMUP00000029154 ENSMMUP00000029152 9544.ENSMMUP00000029154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]