SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029162 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029162
Domain Number 1 Region: 33-238
Classification Level Classification E-value
Superfamily eIF4e-like 8.24e-77
Family Translation initiation factor eIF4e 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029162   Gene: ENSMMUG00000022151   Transcript: ENSMMUT00000031158
Sequence length 243
Comment pep:known chromosome:MMUL_1:12:96441244:96471080:1 gene:ENSMMUG00000022151 transcript:ENSMMUT00000031158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGDSRGERMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGP
AEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHS
DFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVV
SVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTK
ITL
Download sequence
Identical sequences ENSMMUP00000029162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]