SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029229 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029229
Domain Number 1 Region: 236-311
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 99-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.05e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 11-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029229   Gene: ENSMMUG00000022205   Transcript: ENSMMUT00000031232
Sequence length 403
Comment pep:known chromosome:MMUL_1:2:84430297:84440240:1 gene:ENSMMUG00000022205 transcript:ENSMMUT00000031232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE
RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA
GTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATI
PYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQ
TSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL
AQYLITACLETAKSTSGGTPGSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGL
KPVPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY
Download sequence
Identical sequences A0A096NDH7 A0A0D9RN73 A0A2K5JNY2 A0A2K5LTB9 A0A2K5RRB5 A0A2K5XUB4 A0A2K6B9G2 A0A2K6MYH6 A0A2K6PXW4 A0A2K6TNE1 F6ZFV1 G1R5Y3 G7NZX3
ENSPANP00000010923 NP_001247796.1.72884 XP_003257183.1.23891 XP_003257184.1.23891 XP_003257185.1.23891 XP_003936646.1.74449 XP_005547347.1.63531 XP_005547349.1.63531 XP_005547350.1.63531 XP_005547352.1.63531 XP_005547353.1.63531 XP_007982626.1.81039 XP_007982627.1.81039 XP_007982628.1.81039 XP_007982629.1.81039 XP_010363351.1.97406 XP_010363352.1.97406 XP_010363353.1.97406 XP_011737832.1.29376 XP_011737833.1.29376 XP_011737834.1.29376 XP_011737835.1.29376 XP_011737836.1.29376 XP_011737837.1.29376 XP_011814219.1.43180 XP_011841652.1.47321 XP_011890443.1.92194 XP_011890444.1.92194 XP_011890445.1.92194 XP_011890446.1.92194 XP_011890447.1.92194 XP_014986036.1.72884 XP_014986037.1.72884 XP_014986038.1.72884 XP_014986039.1.72884 XP_014986041.1.72884 XP_014986042.1.72884 XP_015301454.1.63531 XP_015301455.1.63531 XP_015301457.1.63531 XP_015301458.1.63531 XP_017401769.1.71028 XP_017401855.1.71028 XP_017714301.1.44346 XP_017714302.1.44346 XP_017714303.1.44346 XP_017714304.1.44346 XP_017714305.1.44346 XP_017714306.1.44346 XP_017714307.1.44346 ENSNLEP00000008605 ENSMMUP00000029229 9544.ENSMMUP00000029229 ENSMMUP00000029229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]