SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029231 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029231
Domain Number 1 Region: 236-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 99-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.32e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 11-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029231   Gene: ENSMMUG00000022205   Transcript: ENSMMUT00000031234
Sequence length 323
Comment pep:known chromosome:MMUL_1:2:84435613:84440205:1 gene:ENSMMUG00000022205 transcript:ENSMMUT00000031234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE
RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA
GTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATI
PYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQ
TSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL
AQYLITAWAAAGLGGLHCQDGSG
Download sequence
Identical sequences ENSMMUP00000029231 XP_007982630.1.81039 XP_012316069.1.9421 XP_015301459.1.63531 XP_017714308.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]