SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029233 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029233
Domain Number 1 Region: 236-311
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 99-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.45e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 11-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029233   Gene: ENSMMUG00000022205   Transcript: ENSMMUT00000031236
Sequence length 387
Comment pep:known chromosome:MMUL_1:2:84434467:84440238:1 gene:ENSMMUG00000022205 transcript:ENSMMUT00000031236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE
RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA
GTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATI
PYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQ
TSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL
AQYLITACLETAKSTSGGTPGSAPADLPAPFSPPLTAPQLPQACWAHPMPSPSPTSSAQA
CALLGSTTCFPRAAAGLGGLHCQDGSG
Download sequence
Identical sequences ENSMMUP00000029233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]