SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029290 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029290
Domain Number 1 Region: 345-409
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.13e-18
Family LIM domain 0.023
Further Details:      
 
Domain Number 2 Region: 286-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.06e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 253-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000206
Family LIM domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029290
Domain Number - Region: 404-432
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00106
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029290   Gene: ENSMMUG00000022246   Transcript: ENSMMUT00000031299
Sequence length 436
Comment pep:known_by_projection chromosome:MMUL_1:5:87554822:87631517:1 gene:ENSMMUG00000022246 transcript:ENSMMUT00000031299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHIDINGRCEYSPHLCFMWHTMNNTNNFRKFDFDYYGLSFSSCFLFFLSFSFPFSSCWKS
FFCCLPLSIKRKIPPKRPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQS
RSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLTSSVASTRSMPESLDSPASGRPGV
ASLTTAAAFKPVGSTGVIKSPSWQRPNQAVPSTGRISNSATSSGSVAPASSALGQPQPSA
QDTLVQRAEHIPAGKRTPMCAQCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYVGFVE
EKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLE
DGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFS
KKDKPLCKKHAHSVNF
Download sequence
Identical sequences ENSMMUP00000029290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]