SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029298 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029298
Domain Number 1 Region: 175-482
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.03e-84
Family Transglutaminase core 0.000000798
Further Details:      
 
Domain Number 2 Region: 7-173
Classification Level Classification E-value
Superfamily E set domains 1.08e-43
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 616-714
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.33e-28
Family Transglutaminase, two C-terminal domains 0.0007
Further Details:      
 
Domain Number 4 Region: 502-614
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.3e-26
Family Transglutaminase, two C-terminal domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029298   Gene: ENSMMUG00000022255   Transcript: ENSMMUT00000031308
Sequence length 720
Comment pep:known_by_projection chromosome:MMUL_1:7:21641251:21665287:-1 gene:ENSMMUG00000022255 transcript:ENSMMUT00000031308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGEPSQRSSGLAGLYAAPAASPVFIKGSGMDALGIKSCDFQAARNNEEHHTKAFSSRR
LFVRRGQPFTIILHFRTPVHAFLPALKKVALIAQTGEQPSKVNRTQATFPVSSLGDRKSW
SAAVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKPRLLGPFTLLFNPWSREDAVFLK
NEAQRTEYLLNQNGLIYLGTADCIQAEPWDFGQFEGDVIDLSLRLLSEDSVEKWSQPVHV
ARVLGALLHYLKEKRVLPTPQTQTTQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVL
AAVACTVLRCLGIPARVVTTFASAQGTGGRLLVDEYYNEEGLQNGEGQRGRIWIFQTSTE
CWMTRPALPQGYDGWQILHSSAPNGGGVLGFCDLVPVRAVKEGTLRLTPAVSDLFAAINA
SCVVWKCCEDGKLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERV
EKEKMEHGKDNGIRPPTLQTANPLYLLLKAPSSLPLRGDTQISVTLVNHSEQEMAVLLAI
GVQAVHYNGVLAAELWRKKLHLMLSANLEQTITIGLFFSNFERNPPENTFLRLTAMATHS
QSSLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSIQNSIDAPMEDCVISILGRGLI
HRERRYRFGSVRPENTMCTKFQFTPTHVGLQRLTVEMDCNMFQNLTNYKNVTVVAPELSA
Download sequence
Identical sequences 9544.ENSMMUP00000029298 ENSMMUP00000029298 ENSMMUP00000029298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]