SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029315 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029315
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 460-587
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 125-235
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-24
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 576-681
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-20
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 345-464
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-19
Family Cadherin 0.0051
Further Details:      
 
Domain Number 6 Region: 13-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000428
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029315   Gene: ENSMMUG00000022272   Transcript: ENSMMUT00000031330
Sequence length 1159
Comment pep:known chromosome:MMUL_1:17:36650698:36742100:1 gene:ENSMMUG00000022272 transcript:ENSMMUT00000031330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQSGLPPAERGGGGRSK
SGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKV
EIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFG
LDVKSRGDGTKFPELVIQKALDREQQTHHTLVLTALDGGEPPRSATIQINVKVIDSNDNS
PVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDPKT
GLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQGA
LSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAVKILDENDNPPRFTKGLYVLQ
VHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSF
NFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRN
AGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVE
LVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISIILL
AAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQSEVEERNAM
NVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG
NNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADS
DQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPA
ANQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLK
AKRALSPLLQEVPSASSSPTKACIEPCTSTKGSLDSCEAKPGALAEASSQYLPTDSQYLS
PSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQLDHPNRDLGRESVDAEEVVR
EIDKLLQDCRGNDPVAVRK
Download sequence
Identical sequences A0A2K5VP38 F6XGK9
9544.ENSMMUP00000029315 NP_001252640.1.72884 XP_005585994.1.63531 ENSMMUP00000029315 ENSMMUP00000029315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]