SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029422 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000029422
Domain Number - Region: 9-69
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0575
Family Troponin I 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029422   Gene: ENSMMUG00000022351   Transcript: ENSMMUT00000031444
Sequence length 100
Comment pep:known_by_projection chromosome:MMUL_1:5:132846824:132850194:1 gene:ENSMMUG00000022351 transcript:ENSMMUT00000031444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDHSSRILYPRHKSLLPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVD
AVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
Download sequence
Identical sequences ENSMMUP00000029422 9544.ENSMMUP00000029422 ENSMMUP00000029423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]