SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029470 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029470
Domain Number 1 Region: 663-958
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-78
Family Protein kinases, catalytic subunit 0.0000000000302
Further Details:      
 
Domain Number 2 Region: 283-475
Classification Level Classification E-value
Superfamily L domain-like 2.24e-46
Family L domain 0.000000186
Further Details:      
 
Domain Number 3 Region: 29-191
Classification Level Classification E-value
Superfamily L domain-like 4.25e-27
Family L domain 0.000000855
Further Details:      
 
Domain Number 4 Region: 460-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.14e-25
Family Growth factor receptor domain 0.0000000548
Further Details:      
 
Domain Number 5 Region: 139-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.17e-19
Family Growth factor receptor domain 0.0000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029470   Gene: ENSMMUG00000022394   Transcript: ENSMMUT00000031496
Sequence length 1078
Comment pep:known chromosome:MMUL_1:3:71134599:71319614:-1 gene:ENSMMUG00000022394 transcript:ENSMMUT00000031496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRG
KSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKY
SFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEF
KDTLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFL
LIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISG
NKNLCYANTINWKKLFGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS
CQNVSRGRECVDKCNVLEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHY
IDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCARNGPKIPS
IATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLR
ILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYV
MASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGM
NYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALES
ILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYM
IMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEE
DMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSF
LQRYSSDPTGALTEDSIDDTFLPVPGEWLVWKHSCSSASLTHSAAASLHHPVSKPGAP
Download sequence
Identical sequences ENSMMUP00000029470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]