SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029471 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029471
Domain Number 1 Region: 708-1003
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-78
Family Protein kinases, catalytic subunit 0.0000000000302
Further Details:      
 
Domain Number 2 Region: 328-520
Classification Level Classification E-value
Superfamily L domain-like 2.3e-46
Family L domain 0.000000186
Further Details:      
 
Domain Number 3 Region: 31-209
Classification Level Classification E-value
Superfamily L domain-like 3.69e-43
Family L domain 0.000000189
Further Details:      
 
Domain Number 4 Region: 505-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.28e-25
Family Growth factor receptor domain 0.0000000548
Further Details:      
 
Domain Number 5 Region: 186-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-19
Family Growth factor receptor domain 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029471   Gene: ENSMMUG00000022394   Transcript: ENSMMUT00000031497
Sequence length 1090
Comment pep:known chromosome:MMUL_1:3:71134599:71319614:-1 gene:ENSMMUG00000022394 transcript:ENSMMUT00000031497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSEFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
VLEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVP
Download sequence
Identical sequences ENSMMUP00000029471 ENSMMUP00000029469 9544.ENSMMUP00000029471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]