SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029528 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029528
Domain Number 1 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 168-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.2e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 112-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 8 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.85e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 11 Region: 700-755
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 12 Region: 1-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 13 Region: 56-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 14 Region: 552-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000106
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029528   Gene: ENSMMUG00000028781   Transcript: ENSMMUT00000031558
Sequence length 756
Comment pep:known_by_projection chromosome:MMUL_1:19:43228365:43230968:-1 gene:ENSMMUG00000028781 transcript:ENSMMUT00000031558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKNGSELTQQQETHTGEKLYKCKGCGKAFCHFSYFVKHQRIHTGEKPYACKEYGKAFISG
SHLIQHQKIYIDERPHECQESVKAFRPSTHLIQHRRIHTGDKPYECKECGKSFTSGSTLN
QHQQIHTGEKPYHCKQCGKSFTVGSTLIRHQQIHTGEKPYDCKECGKSFASGSALIRHQR
IHTGEKPYDCKECGKSFTFHSALIRHQRIHTGEKPYDCKECGKSFTFHSGLIGHQVIHTG
EKPYDCKECGKSFTAGSTLIQHQRIHTGEKPYDCKECGKSFASGSALLQHQRIHTGEKPY
CCKECGKSFTFRSTRNRHQRIHTGEKPYDCKECGKSFASGSALLQHQRIHTGEKPYHCKE
CGKSFTFRSGLIGHQAVHTGEKPYDCKECGKSFTSRSALIQHQRIHTGEKPYHCKECGKS
FAVGSTLIQHQQIHTGEKPYDCKECGKAFISVSGLTQHHRIHTGEKPYECPECGKAFRQR
TYLNQHQRIHTGEKPYECKECGKSFASHSTLIQHQRIHTGEKPYHCKECGKSFTLRSALI
QHRPIHTGEKRYSCKECGKSFTCHSTLIEHQRIHTGEKPYHCKECGKSFTFRSAIIQHQR
IHTGEKPYDCKECGKAFRRRSKLTQHQRIHTGEKPYQCHECGKAFVRFSGLTKHHSIHTG
EKPYECKTCGKSFRQRTHLTLHQRIHTGDRPYECKECGKSFTCGSELIRHQRTHTGEKPY
DCKECGKAFRCPSQLSQHKRIHTGERTYQCPECGKA
Download sequence
Identical sequences ENSMMUP00000029528 ENSMMUP00000029528 9544.ENSMMUP00000029528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]