SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029646 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029646
Domain Number 1 Region: 362-438
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.96e-29
Family VHP, Villin headpiece domain 0.00000718
Further Details:      
 
Domain Number 2 Region: 27-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.27e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 86-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000499
Family LIM domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1-26
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000769
Family LIM domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029646   Gene: ENSMMUG00000021657   Transcript: ENSMMUT00000031688
Sequence length 438
Comment pep:known chromosome:MMUL_1:6:145681572:145732468:1 gene:ENSMMUG00000021657 transcript:ENSMMUT00000031688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKC
ETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKK
LKHRRTSETSISPPGSSIGSPNRVICDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFS
RSPHHYYRSAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPAYSPDPYYASES
EYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPP
RSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHY
DSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEF
DRLALWKRNELKKQARLF
Download sequence
Identical sequences ENSMMUP00000029646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]