SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029709 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029709
Domain Number 1 Region: 615-818
Classification Level Classification E-value
Superfamily Macro domain-like 1.61e-53
Family Macro domain 0.0000599
Further Details:      
 
Domain Number 2 Region: 1034-1234
Classification Level Classification E-value
Superfamily Macro domain-like 4.04e-46
Family Macro domain 0.00074
Further Details:      
 
Domain Number 3 Region: 848-1024
Classification Level Classification E-value
Superfamily Macro domain-like 4.04e-41
Family Macro domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1455-1636
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.95e-41
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 5 Region: 1328-1437
Classification Level Classification E-value
Superfamily WWE domain 9.03e-21
Family WWE domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029709
Domain Number - Region: 59-124
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000869
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029709   Gene: ENSMMUG00000022569   Transcript: ENSMMUT00000031754
Sequence length 1637
Comment pep:known chromosome:MMUL_1:2:42684756:42723184:1 gene:ENSMMUG00000022569 transcript:ENSMMUT00000031754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTLLVENISGLSSDDFQLEVIRDFDVAVVTFQKHIDTVRFVDDCTRHHSIKQLQLSPRL
LEVTKTIRVENLPPGVDDYSLKLFFENPYSGGGRVANVEYFPEESSALIEFFDRKVLDTI
MATKLDFNKMPLSVFPYYASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEE
INDEMRRCHCELTWSQLSGKVTIRPAATLVNEGRPRIKTWQADTSTALSSIRSKYKVTPI
KVDPTMWDTIKNDVKDDRILIEFDTLKEMIILAGKSEDVQSIEVHVKELIESTTQKIKRE
EQSLKEKMVISPGRYFLLCHSSLLDHLHTECPEIEICYDGVTQHLCLKGPSVDVYKVKCA
IQEKVYTMAQKNIQVSPEIFQFLQQVNWKEFSKCLFIAQEILALYELEGTTVLLTSCSSE
ALLEAEKQMLSALDYKRIEVENKEVLNGKNWKGLTHNLRKTKNFSPNTVIINELSSETTA
EVIITGCVKKVNETYALLFNFIEQNMKIERLVEVKPSLVIDYLKTEKKLFLPKIKRTNVQ
VSFNPENKQKGILLTGSKTEVLKAMDIVKQARDSVCVKSVHIDKPGAKMFFRDKAWFYQR
EIKRLFGCYIELQENEEVKEGGSPSGQKCFSRTVLAPGVVLIVQQGDLAQLPVDVVVNAS
NEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGP
RWNGCEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKE
NFQRKKDGHYLKEIYLVDVSEKTVEAFAEAVKTVFKATLPDTAAPPSLPAAAGPGKTSWK
QGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPSDLELSRGPLSKALLEKAGPALQEELDT
VGQGMTVSVGTVLKTNSWNLDCRYVLHVVAPEWRNGSTSSLKVMEDIIRECMEITDSLSL
KSIAFPAIGTGNLGFPKTIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIKAFSD
EFARRANGNLISDKISKAEDTQGFYGTVSSPDLGVHEMKIGSIIFQVASGDITKEEADVI
VNSTSKSFNLKAGVSKAILECAGQNVEMECSQQAQQHKNDYIITGGGFLKCKNIIHVIGG
NDVKSSVSSVLQECEKQNYSSICLPAIGTGNAKQDPEKVAEAIIDAIEDFVQKGSAKSVK
KVKVVIFLPQVLDVFYAIMKKREGTQVSSQQSMMSKLASFLRISKQPPKKENHLVLEKKT
ESATFRVCGENVMCVEQTISWLQDLIEKEQCPYTSEDEYIKYFDEKEYQKLKELQEKLNI
NIFLDNKRPLIKVLGISRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNT
FYRFDKITNLKLEDARREKKKTIDVKINHQHYTVNLNTYTATDAKGLSLSVQRLVKSEVD
IPAHWSDMKQQNFCVVELQPRDPEYNTVASKFNQTCAHFRIEKIERIQNPDLWNSYQAKK
KTMDAKNGQTMNEKQLFHGTDAGSVPYVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSAN
DTYSRPDANGRKHMYYVRVLTGIYTHGNQSLIVPPSKNPQNPTDLYDTVTDNVQHPNLFV
VFYDYQAYPEYLITFRR
Download sequence
Identical sequences ENSMMUP00000029709 9544.ENSMMUP00000029709 ENSMMUP00000029709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]