SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029710 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029710
Domain Number 1 Region: 95-204
Classification Level Classification E-value
Superfamily WWE domain 5.23e-22
Family WWE domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029710   Gene: ENSMMUG00000022569   Transcript: ENSMMUT00000031755
Sequence length 282
Comment pep:known chromosome:MMUL_1:2:42684756:42716339:1 gene:ENSMMUG00000022569 transcript:ENSMMUT00000031755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLASFLRISKQPPKKENHLVLEKKTESATFRVCGENVMCVEQTISWLQDLIEKEQCPY
TSEDEYIKYFDEKEYQKLKELQEKLNINIFLDNKRPLIKVLGISRDVMQARDEIEAMIKR
VRLAKEQESRADCISEFIEWQYNDNNTFYRFDKITNLKLEDARREKKKTIDVKINHQHYT
VNLNTYTATDAKGLSLSVQRLVKSEVDIPAHWSDMKQQNFCVVELQPRDPEYNTVASKFN
QTCAHFRIEKVSVMIRACSPSCWEAEVEGWHEPRSLRPVWVT
Download sequence
Identical sequences ENSMMUP00000029710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]